PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 59069
Common NameSELMODRAFT_59069
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family SRS
Protein Properties Length: 123aa    MW: 13259.1 Da    PI: 9.8167
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
59069genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702102.38.6e-32259663
  DUF702  6 asCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasska 63
            a+C++CGnqakkdC+++RCRtCCksr++dC+thvkstWvpaakrrerq+ +aaa +  
   59069  2 ATCKECGNQAKKDCQFQRCRTCCKSRNYDCSTHVKSTWVPAAKRRERQALEAAAIAAG 59
            68*********************************************99998875543 PP

2DUF70269.51.1e-2181123110152
  DUF702 110 sseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGl 152
              ++a+f+cv+v++++dge+e+aYq++v+igGhvfkG+LydqG+
   59069  81 AAQALFKCVKVTGIEDGENEYAYQATVKIGGHVFKGVLYDQGV 123
             689**************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.6E-28259IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.1E-26345IPR006510Zinc finger, lateral root primordium type 1
PfamPF051425.2E-1981123IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016247.8E-2681123IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
GATCKECGNQ AKKDCQFQRC RTCCKSRNYD CSTHVKSTWV PAAKRRERQA LEAAAIAAGQ  60
PRPRSKRTRS LALGGGSSSA AAQALFKCVK VTGIEDGENE YAYQATVKIG GHVFKGVLYD  120
QGV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002973968.11e-86hypothetical protein SELMODRAFT_59069, partial
SwissprotQ94CK93e-43LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLD8RSU71e-86D8RSU7_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ249233e-86(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13131549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21400.12e-33SHI-related sequence3
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]